PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN21370.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 332aa    MW: 37674.4 Da    PI: 6.8262
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN21370.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.91.8e-161365148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT.....TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg.....kgRtlkqcksrwqkyl 48
                     rg W++eEde+l+++++ +G ++W+++++  g     + R++k+c++rw +yl
       KHN21370.1 13 RGLWSPEEDEKLLRYINTHGHKSWSSVPKFAGihlsrLQRCGKSCRLRWINYL 65
                     788************************************************97 PP

2Myb_DNA-binding55.51.3e-1771114146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg++T+eE+++++d ++ lG++ W+ Ia++++ gRt++++k++w++
       KHN21370.1  71 RGSFTAEEEQIIIDIHRILGNR-WAQIAKHLP-GRTDNEVKNFWNS 114
                      89********************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.3E-24568IPR009057Homeodomain-like
PROSITE profilePS5129415.946865IPR017930Myb domain
SuperFamilySSF466898.2E-2910112IPR009057Homeodomain-like
SMARTSM007174.9E-131267IPR001005SANT/Myb domain
PfamPF002491.5E-151365IPR001005SANT/Myb domain
CDDcd001678.60E-111665No hitNo description
PROSITE profilePS5129426.46866120IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.5E-2669121IPR009057Homeodomain-like
SMARTSM007171.8E-1670118IPR001005SANT/Myb domain
PfamPF002498.7E-1671114IPR001005SANT/Myb domain
CDDcd001673.90E-1273113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MGHRCCSKQK IKRGLWSPEE DEKLLRYINT HGHKSWSSVP KFAGIHLSRL QRCGKSCRLR  60
WINYLRPDLK RGSFTAEEEQ IIIDIHRILG NRWAQIAKHL PGRTDNEVKN FWNSCIKKKL  120
ISQGLDPQTH TLLSSHRRSS ACTISNNIHQ NSNSIFIMSS HIPNAPFETT CQTFSTLPKP  180
PPNIVQTPSS IVSSEFQTLS TILSDDGEPL QHLPYELLME NATNICSPTY MNPSAVELCN  240
DDNNVNWVSR LNVHDFSAQT LEEGAQVLQV QQEKGKTFDD KGSDVREANK GNLETSVSFE  300
SSNFDLGFLE SVLTSEFISH DLNCMDELAW NF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-31131207108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00350DAPTransfer from AT3G12720Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003532906.10.0PREDICTED: transcription factor MYB26-like
SwissprotQ9SPG36e-69MYB26_ARATH; Transcription factor MYB26
TrEMBLA0A0B2QJ490.0A0A0B2QJ49_GLYSO; Transcription factor MYB86
STRINGGLYMA08G17371.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF34663267
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12720.17e-86myb domain protein 67
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]